PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr011351.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 280aa    MW: 31703.2 Da    PI: 6.7488
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr011351.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.63.4e-09955347
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                      WT+eE + +  a +++  +   +W+++a++++ g+t+ +++  +q++
      Pbr011351.1  9 EWTKEENKMFESALAMFDEKtpdRWRKVAEMIP-GKTEIDVIKQYQDL 55
                     6********************************.***********986 PP

2Myb_DNA-binding41.92.4e-13112156347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+r    ++t+ q+ s+ qky
      Pbr011351.1 112 PWTPEEHRRFLLGLLKHGKGDWRNISRNYVVTKTPTQVASHAQKY 156
                      7*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.4E-6658IPR001005SANT/Myb domain
SuperFamilySSF466897.18E-12863IPR009057Homeodomain-like
PROSITE profilePS500906.713856IPR017877Myb-like domain
PfamPF002497.1E-8955IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-4952IPR009057Homeodomain-like
CDDcd001671.04E-7955No hitNo description
PROSITE profilePS5129417.702104161IPR017930Myb domain
SuperFamilySSF466893.45E-16107161IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-16108160IPR006447Myb domain, plants
SMARTSM007172.4E-9109159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-9110156IPR009057Homeodomain-like
PfamPF002497.1E-11112156IPR001005SANT/Myb domain
CDDcd001673.27E-9112157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MADYDWYSEW TKEENKMFES ALAMFDEKTP DRWRKVAEMI PGKTEIDVIK QYQDLEEDVC  60
EIESGRFPIP PGYPQSYFTL ELGDDRDFDA NRKRPAKAAA RGSDQERKKG IPWTPEEHRR  120
FLLGLLKHGK GDWRNISRNY VVTKTPTQVA SHAQKYFMRQ HSGGKDKRRP SIHDITTVNL  180
TSNTPPETNG SPSDQSPPEQ KSTESPNVLL DWNAADDGGA AMVFGSTHGN LLDPSPYDGP  240
ADGIKMQFQK LYSHAHYAAH ATPQNSLYLR QSARHQIHG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-1410701171RADIALIS
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009350979.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-84DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLD9ZJ701e-174D9ZJ70_MALDO; MYBR domain class transcription factor
STRINGVIT_13s0019g03370.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.21e-78MYB family protein